PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 648aa    MW: 71917 Da    PI: 7.125
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.2e-094074441954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_011080922.1 407 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 444
                     554459******************************88 PP

2BELL114.46e-37271339472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elq++k+kLl++leeVdkrYk+y++q+++v+ssFeavag g+a++Y ++A++a+S+hFrcL+d i +qi
  XP_011080922.1 271 ELQRRKTKLLQMLEEVDKRYKHYCDQMKAVVSSFEAVAGNGAATVYSAMASRAMSKHFRCLRDGILSQI 339
                     89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-50207337IPR006563POX domain
PfamPF075264.4E-46212335IPR006563POX domain
PROSITE profilePS5007112.179385448IPR001356Homeobox domain
SMARTSM003895.8E-9388452IPR001356Homeobox domain
CDDcd000862.61E-11388449No hitNo description
SuperFamilySSF466896.42E-17389454IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27391454IPR009057Homeodomain-like
PfamPF059208.7E-18405444IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MAGPSIEKPR EMIASTGYCY SGASSSHHLV TQLQSFDPNP EIYNMSTAGM GGMIGFPSKT  60
TLHQENGSGL WKGFFGGKPF GGNPAGHHSS SSKEINEPTS SEFHHHDFSK QQHDLTTAVS  120
DTTNETLMVS PDSSYHHNRL LAEMDPSLRS CVFPFEGNER PSQGLSLSLS SSNPSSIGLQ  180
SFEFRQQHED LRFGPSSSRS VNVQGQQHQS QVVRNSKYLG PAQELLNEFC NLGTKETDKS  240
SSKIKVQKMS GEWQDEDAVK KQSLYSLDLL ELQRRKTKLL QMLEEVDKRY KHYCDQMKAV  300
VSSFEAVAGN GAATVYSAMA SRAMSKHFRC LRDGILSQIR ATKKAMGDKD TSTPGTMKGE  360
TPRLRILDQT LRQQRALQQM SMMESHPWRP QRGLPERSVS VLRAWLFEHF LHPYPSDVDK  420
HILARQTGLS RSQVSNWFIN ARVRLWKPMV EEMYLEEQKE EEGIGDGASA AANLDDNHHD  480
HHGLTIQNPS RTKDQKPAHD QLVRIDSECL SSIINNTDKN ASKNKSKAAA LQNHEQQNHP  540
CSFGRPGDSY SAMELDFSSY THHHSSAGGG PTNYGGGGVS LTLGLHQHGG GGGVSLPFSP  600
VSVQSSLFYP RDHMEDCQTV QYSLLDSENQ NLPYRNLMGA QLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A8e-16394452563Homeobox protein Meis2
4xrm_B8e-16394452563Homeobox protein Meis2
4xrs_A6e-16394451158Homeobox protein Meis1
4xrs_B6e-16394451158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080922.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-144BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-118TALE family protein